1
/
of
1
Peptide Hub
GLP-2 - 50 Vials
GLP-2 - 50 Vials
Regular price
$9,350.00 USD
Regular price
$14,850.00 USD
Sale price
$9,350.00 USD
Unit price
/
per
Shipping calculated at checkout.
Couldn't load pickup availability
GLP-2 is a synthetic peptide designed specifically for laboratory research purposes. Structurally engineered to engage glucagon-like peptide-1 (GLP-1) and glucose-dependent insulinotropic polypeptide (GIP) receptors, GLP-2 facilitates studies exploring receptor interactions, signaling pathways, and metabolic processes in controlled experimental conditions.
Chemical Sequence:
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
This product is intended strictly for in vitro laboratory research and is NOT approved for human or animal consumption. The purchaser must ensure compliance with all relevant laboratory protocols and regulatory guidelines.
